missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95063

Invitrogen™ Human MEK6 (aa 2-61) Control Fragment Recombinant Protein

Catalog No. RP95063
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95063 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95063 Supplier Invitrogen™ Supplier No. RP95063
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MKK6 (MEK6, MAP2K6) is a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. Tissue specificity: Isoform 2 is only expressed in skeletal muscle. Isoform 1, on the other hand, is found in skeletal muscle, heart, and in lesser extent in liver or pancreas.

Specifications

Accession Number P52564
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5608
Name Human MEK6 (aa 2-61) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Dual specificity mitogen-activated protein kinase kinase 6; MAP kinase kinase 6; MAP2K6; MAPK/ERK kinase 3; MAPK/ERK kinase 6; MAPKK 3; MAPKK 6; MAPKK3; MAPKK6; MEK 3; MEK 6; MEK3; MEK6; mitogen activated protein kinase kinase 6; mitogen-activated protein kinase kinase 6; MKK3; MKK6; PRKMK3; Prkmk6; protein kinase, mitogen activated, kinase 6; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPK kinase 2; SAPK kinase 3; SAPKK2; SAPKK-2; SAPKK3; SAPKK-3; SKK3; Stress-activated protein kinase kinase 3
Common Name MEK6
Gene Symbol MAP2K6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less