missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MEIG1 Control Fragment Recombinant Protein

Catalog No. RP97201
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97201 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97201 Supplier Invitrogen™ Supplier No. RP97201

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60769 (PA5-60769. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MEIG1, a murine gene first identified as a testis specific gene, is a chromosome/chromatin-binding protein initially expressed during meiosis but retained in the germ cell nucleus throughout later stages of spermatogenesis. MEIG1 is a highly conserved basal metazoan gene that is indispensable for mouse spermatogenesis. It is important for normal meiotic differentiation and absolutely crucial for terminal differentiation of spermatozoa. MEIG1 encodes two alternative transcripts, designated 2a2 and 11a2, both of which encode for a common ORF but differing in their 5' untranslated region (5'UTR) due to alternative promoters.

Specifications

Accession Number Q5JSS6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 644890
Name Human MEIG1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bA2K17.3; Meg1; Meig1; meiosis expressed gene 1; meiosis expressed gene 1 homolog; meiosis expressed gene 1 protein homolog; meiosis/spermiogenesis associated 1; Meiosis-expressed gene 1 protein; MLZ-278; Protein expressed in male leptotene and zygotene spermatocytes 278; SPATA39; spermatogenesis associated 39
Common Name MEIG1
Gene Symbol MEIG1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MASSDVKPTSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHKVK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less