missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MEI1 (aa 588-670) Control Fragment Recombinant Protein

Catalog No. RP95369
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95369 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95369 Supplier Invitrogen™ Supplier No. RP95369
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61916 (PA5-61916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The predominant cause of spermatogenic arrest of meiosis is the failure of homologous chromosomes to accurately synapse. MEI1 (Meiosis inhibitor protein 1), also designated Meiosis defective protein 1, is a 1274 amino acid protein that is likely required for the formation of genetically programmed double-strand breaks, the first step in the initiation of meiosis. With predominant expression in testis, it is likely that defects of the gene encoding MEI1 results in male infertility. Interestingly, studies show that genetic variation in the MEI gene possibly predisposes European Americans but not Israeli men to infertility by meiotic arrest. Human MEI1 shares 79% sequence similarity with its mouse homolog. There are seven isoforms of MEI1 that are produced as a result of alternative splicing events.

Specifications

Accession Number Q5TIA1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 150365
Name Human MEI1 (aa 588-670) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4932408F18Rik; MEI1; meiosis defective 1; meiosis defective protein 1; meiosis inhibitor 1; meiosis inhibitor protein 1; meiotic double-stranded break formation protein 1; SPATA38; spermatogenesis associated 38
Common Name MEI1
Gene Symbol MEI1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HMKEKFSKKLASSSFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNLLSAPEKTGPPSKEELSAVSELLQHGLPQISSRS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less