missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89875

Invitrogen™ Human MCPH1 (aa 555-701) Control Fragment Recombinant Protein

Catalog No. RP89875
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89875 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89875 Supplier Invitrogen™ Supplier No. RP89875

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52535 (PA5-52535. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is implicated in chromosome condensation and DNA damage induced cellular responses, and may play a role in neurogenesis and regulation of the size of the cerebral cortex.

Specifications

Accession Number Q8NEM0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79648
Name Human MCPH1 (aa 555-701) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430437K10Rik; BRCT-repeat inhibitor of TERT expression 1; BRIT 1; BRIT1; D030046N04Rik; FLJ12847; Mcph1; MCT; Microcephalin; microcephalin 1; microcephaly, primary autosomal recessive 1; RGD1560642; truncated microcephalin
Common Name MCPH1
Gene Symbol MCPH1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less