missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97206

Invitrogen™ Human MCMBP (aa 118-214) Control Fragment Recombinant Protein

Catalog No. RP97206
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97206 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97206 Supplier Invitrogen™ Supplier No. RP97206

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58410 (PA5-58410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MEK1 (Mitogen activated protein kinase kinase 1) catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases. MEK1 activates ERK1 and ERK2 MAP kinases. Mitogen activated protein kinase kinase 2 (MEK2 or MAPKK2) is a member of a family of tyrosine/threonine protein kinases that activate the ERK1 and 2 and MAPK enzymes by phosphorylating both residues within the threonine/glutamate/tyrosine (TEY) motif in the activation loop. MEK1 and 2 are also activated by dual phosphorylation, which occurs on serine 218 and 222, in the activation loop of the MEK. Threonine 292 of MEK1 is phosphorylated by ERK 2, which serves as a negative feedback loop by suppressing activation of MEK1.

Specifications

Accession Number Q9BTE3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79892
Name Human MCMBP (aa 118-214) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110007A13Rik; AU017382; BC025641; C10orf119; cj119; MCM (minichromosome maintenance deficient) binding protein; MCM-binding protein; Mcmbp; MCM-BP; minichromosome maintenance complex binding protein; Mini-chromosome maintenance complex-binding protein; minichromosome maintenance complex-binding protein; RGD1306730
Common Name MCMBP
Gene Symbol MCMBP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less