missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MCL-1 (aa 117-219) Control Fragment Recombinant Protein

Catalog No. RP88651
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88651 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88651 Supplier Invitrogen™ Supplier No. RP88651
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MCL1 (Myeloid cell leukemia-1) belongs to the Bcl-2 family and is involved in programing, differentiation and concomitant maintenance of cell viability, but not of proliferation. Isoform 1 of MCL1 inhibits apoptosis while isoform 2 promotes it. The carboxy terminal of MCL1 and bcl-2 share significant sequence homology. Expression of MCL1 is increased upon exposure of ML-1 cells to various types of DNA damaging agents (e.g. ionizing radiation, ultraviolet radiation, and alkylating drugs) along with increases in GADD45 and Bax and a decrease in bcl-2. Enhanced expression of MCL1, prominently associated with mitochondria, complements the continued expression of bcl-2 in ML-1 cells undergoing differentiation. Like bcl-2, MCL1 has the capacity to promote cell viability under conditions that otherwise cause apoptosis. While the mechanism by which MCL1 inhibits apoptosis is not known, it is thought that it may heterodimerize and neutralize pro-apoptotic members of the Bcl-2 family such as Bim or Bak. MCL1 was originally identified in differentiating myeloid cells, but has since been shown to be expressed in multiple cell types. MCL1 is essential for embryogenesis and for the development and maintenance of B and T lymphocytes in animals. MCL1 exists as at least two distinct isoforms designated MCL1L and MCL1S. In marked contrast to the larger isoform of MCL1, overexpression of MCL1S promotes cell death.

Specifications

Accession Number Q07820
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4170
Name Human MCL-1 (aa 117-219) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW556805; BCL2 family apoptosis regulator; BCL2L3; bcl2-L-3; Bcl-2-like protein 3; bcl-2-related protein EAT/mcl1; EAT; Induced myeloid leukemia cell differentiation protein Mcl-1; induced myeloid leukemia cell differentiation protein Mcl-1 homolog; Mcl1; Mcl-1; mcl1/EAT; MCL1-ES; MCL1L; MCL1S; MCL-1 S; MGC104264; MGC1839; myeloid cell leukemia 1; myeloid cell leukemia ES; myeloid cell leukemia sequence 1; myeloid cell leukemia sequence 1 (BCL2-related); TM
Common Name MCL-1
Gene Symbol MCL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less