missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105236

Invitrogen™ Human MBNL2 (aa 95-144) Control Fragment Recombinant Protein

Catalog No. RP105236
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105236 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105236 Supplier Invitrogen™ Supplier No. RP105236

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66515 (PA5-66515. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscle blind B protein. Drosophila muscle blind is a gene required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined.

Specifications

Accession Number Q5VZF2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10150
Name Human MBNL2 (aa 95-144) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110002M11Rik; AI047808; AI837313; AI849185; AL118326; DKFZp781H1296; fj89c04; Kiaa4072; MBLL; MBLL39; mbnl2; MGC120625; MGC120626; MGC120628; mKIAA4072; MLP1; muscleblind like splicing regulator 2; muscleblind-like 2; muscleblind-like protein 1; Muscleblind-like protein 2; Muscleblind-like protein-like; Muscleblind-like protein-like 39; muscleblind-like splicing regulator 2; PRO2032; R75232; RP11-128N14.1; wu:fj89c04
Common Name MBNL2
Gene Symbol MBNL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less