missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95228

Invitrogen™ Human MARK2 (aa 545-612) Control Fragment Recombinant Protein

Catalog No. RP95228
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95228 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95228 Supplier Invitrogen™ Supplier No. RP95228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARK2 is a serine/threonine protein kinase involved in the control of cell polarity and microtubule stability. Several cDNA clones have been isolated that encoded two isoforms of the human ser/thr protein kinase EMK1. These isoforms were characterized by the presence of a 162-bp alternative exon that gave rise to two forms, one containing the exon and the other one lacking it. Both forms were found to be coexpressed in a number of selected cell lines and tissue samples. The human EMK1 was shown to be encoded by a single mRNA ubiquitously expressed.

Specifications

Accession Number Q7KZI7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2011
Name Human MARK2 (aa 545-612) Control Fragment
Quantity 100 μL
Gene Alias ELKL motif kinase; ELKL motif kinase 1; Emk; EMK1; EMK-1; MAP/microtubule affinity regulating kinase 2; MAP/microtubule affinity-regulating kinase 2; MARK2; mark2 {ECO:0000312; MGC99619; microtubule affinity regulating kinase 2; OTTHUMP00000218338; OTTHUMP00000218339; OTTHUMP00000218340; OTTHUMP00000218343; Par-1; PAR1 homolog; PAR1 homolog b; Par1b; Par-1 b; RGD:708483}; Ser/Thr protein kinase PAR-1 B; serine/threonine kinase; serine/threonine protein kinase EMK; serine/threonine-protein kinase MARK2; testicular tissue protein Li 117
Common Name MARK2
Gene Symbol MARK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less