missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94987

Invitrogen™ Human MAPKBP1 (aa 991-1077) Control Fragment Recombinant Protein

Catalog No. RP94987
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94987 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94987 Supplier Invitrogen™ Supplier No. RP94987

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP kinases play a significant role in many biological processes, including cell adhesion and spreading, cell differentiation and apoptosis. MAPKBP-1 (mitogen-activated protein kinase binding protein 1), also known as JNKBP-1, is a 1,514 amino acid protein that contains twelve WD repeats. Induced by TRAF2 (TNF receptor-associated factor 2) and Tak1 (TGF-beta-activated kinase 1), MAPKBP-1 is thought to act an adaptor protein for NFkappaB (nuclear factor kappa-B) activation. MAPKBP-1 interacts with JNK3 and may promote TRAF2 polyubiquitination. MAPKBP-1 exists as six alternatively spliced variants and is encoded by a gene located on human chromosome 15. Human chromosome 15 houses over 700 genes and comprises nearly 3% of the human genome. Angelman syndrome, Prader-Willi syndrome, Tay-Sachs disease and Marfan syndrome are all associated with defects in chromosome 15-localized genes.

Specifications

Accession Number O60336
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 23005
Name Human MAPKBP1 (aa 991-1077) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2810483F24Rik; AW123212; JNK-binding protein 1; JNKBP1; JNKBP-1; Jun N-terminal kinase binding protein 1; Jun N-terminal kinase-binding protein 1; KIAA0596; Mapkbp1; mitogen activated protein kinase binding protein 1; mitogen-activated protein kinase binding protein 1; mitogen-activated protein kinase-binding protein 1; mKIAA0596
Common Name MAPKBP1
Gene Symbol Mapkbp1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less