missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAPKAPK2 (aa 362-398) Control Fragment Recombinant Protein

Catalog No. RP106093
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106093 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106093 Supplier Invitrogen™ Supplier No. RP106093
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-83779 (PA5-83779, PA5-111580 (PA5-111580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPKAPK2 mediates p38 and ERK signaling in vivo. It is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation, and cell proliferation. MAPKAPK2 encodes a member of the Ser/Thr protein kinase family. MAPKAPK2 is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, MAPKAPK2 is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for MAPKAPK2.

Specifications

Accession Number P49137
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9261
Name Human MAPKAPK2 (aa 362-398) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA960234; MAP kinase-activated protein kinase 2; MAPK activated protein kinase 2; MAPK-activated protein kinase 2; MAPKAP kinase 2; Mapkapk2; MAPKAP-K2; MAPKAPK-2; mitogen-activated protein kinase-activated protein kinase 2; MK2; MK-2; Rps6kc1
Common Name MAPKAPK2
Gene Symbol MAPKAPK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less