missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107570

Invitrogen™ Human MAN2C1 (aa 202-291) Control Fragment Recombinant Protein

Catalog No. RP107570
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107570 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107570 Supplier Invitrogen™ Supplier No. RP107570

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66917 (PA5-66917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hydrolysis of terminal, non-reducing alpha-D-mannose residues in alpha-D-mannosides. Target protein plays a role in the processing of asparagine-linked oligosaccharides.

Specifications

Accession Number Q9NTJ4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4123
Name Human MAN2C1 (aa 202-291) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha mannosidase 6A8B; Alpha-D-mannoside mannohydrolase; alpha-mannosidase 2C1; MAN2C1; MAN6A8; MANA; MANA1; Mannosidase alpha class 2 C member 1; mannosidase, alpha 6A8; mannosidase, alpha A, cytoplasmic; mannosidase, alpha, class 2 C, member 1; testicular tissue protein Li 115
Common Name MAN2C1
Gene Symbol MAN2C1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less