missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAN2B2 (aa 695-790) Control Fragment Recombinant Protein

Catalog No. RP96590
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96590 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96590 Supplier Invitrogen™ Supplier No. RP96590

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57911 (PA5-57911. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q9Y2E5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23324
Name Human MAN2B2 (aa 695-790) Control Fragment
Quantity 100 μL
Gene Alias 135 kD alpha-D-mannosidase; 135 kDa alpha-D-mannosidase; Ab2-450; core-specific lysosomal alpha-1,6-Mannosidase; epididymis-specific alpha-mannosidase; HMG17L3; Kiaa0935; Man2b2; mannosidase 2, alpha B2; mannosidase alpha class 2 B member 2; mannosidase, alpha, class 2 B, member 2; mKIAA0935; NHC
Common Name MAN2B2
Gene Symbol MAN2B2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLCHRIEQEYQAGPLELNREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRLVLLSERAHGISSQGNGQVE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less