missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90586

Invitrogen™ Human MAN2A2 (aa 568-707) Control Fragment Recombinant Protein

Catalog No. RP90586
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90586 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90586 Supplier Invitrogen™ Supplier No. RP90586

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53563 (PA5-53563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.

Specifications

Accession Number P49641
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4122
Name Human MAN2A2 (aa 568-707) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700052O22Rik; 4931438M07Rik; AI480988; alpha mannosidase IIx; alpha-mannosidase 2 x; Alpha-mannosidase IIx; MAN IIx; Man2a2; Mana2x; mannosidase 2, alpha 2; mannosidase alpha class 2 A member 2; mannosidase, alpha type II-X; mannosidase, alpha, class 2 A, member 2; mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase; manosidase, alpha-, type II, isozyme X; MX
Common Name MAN2A2
Gene Symbol MAN2A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less