missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAGI1 (aa 686-782) Control Fragment Recombinant Protein

Catalog No. RP105869
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105869 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105869 Supplier Invitrogen™ Supplier No. RP105869

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65111. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

Accession Number Q96QZ7
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9223
Name Human MAGI1 (aa 686-782) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AIP3; AIP-3; Atrophin-1-interacting protein 3; BAI1-associated protein 1; Baiap1; BAP1; BAP-1; Gukmi1; MAGI1; Magi-1; MAGI1c; Magi1d; membrane associated guanylate kinase, WW and PDZ domain containing 1; membrane-associated guanylate kinase inverted 1; Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; mKIAA4129; TNRC19; Trinucleotide repeat-containing gene 19 protein; WW domain-containing protein 3; WWP3
Common Name MAGI1
Gene Symbol Magi1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less