missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LZIC (aa 1-90) Control Fragment Recombinant Protein

Catalog No. RP94368
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94368 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94368 Supplier Invitrogen™ Supplier No. RP94368

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55790. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZIC belongs to the CTNNBIP1 family. It is ubiquitously expressed with highest levels in kidney. LZIC is up-regulated in several cases of gastric cancers.

Specifications

Accession Number Q8WZA0
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 84328
Name Human LZIC (aa 1-90) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1810030J04Rik; AW047580; EGK_00210; leucine zipper and CTNNBIP1 domain containing; leucine zipper and CTNNBIP1 domain-containing protein; Leucine zipper and ICAT homologous domain-containing protein; leucine zipper domain and ICAT homologous domain containing; LZIC; Protein LZIC
Common Name LZIC
Gene Symbol LZIC
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less