missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LUC7L3 (aa 187-270) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92020
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54125 (PA5-54125. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.Specifications
| O95232 | |
| Blocking Assay, Control | |
| 51747 | |
| 100 μL | |
| 3300001P08Rik; cAMP regulatory element-associated protein 1; cisplatin resistance associated overexpressed protein; cisplatin resistance-associated overexpresse protein-like protein; cisplatin resistance-associated overexpressed protein; cisplatin resistance-associated-overexpressed protein; CRA; CREAP1; CREAP-1; CRE-associated protein 1; Crop; FLJ11063; hLuc7A; LUC7 like 3 pre-mRNA splicing factor; Luc7A; LUC7L3; LUC7-like 3; LUC7-like 3 (S. cerevisiae); LUC7-like 3 pre-mRNA splicing factor; luc7-like protein 3; O48; OA48-18; okadaic acid-inducible phosphoprotein OA48-18; RGD1307981; zgc:136380; zgc:158165 | |
| LUC7L3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LUC7L3 (aa 187-270) Control Fragment | |
| RUO | |
| LUC7L3 | |
| Unconjugated | |
| Recombinant | |
| KQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRDERLKKEKQEREEREKEREREREERER | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |