missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LSP1 (aa 173-264) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92040
Description
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82689 (PA5-82689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.Specifications
| P33241 | |
| Blocking Assay, Control | |
| 4046 | |
| 100 μL | |
| 1 BAC CH230-300K22 (Children's Hospital Oakland Research Institute) complete; 47 kDa actin binding protein; 47 kDa actin-binding protein; 52 kDa phosphoprotein; F-actin binding and cytoskeleton associated protein; leufactin (leukocyte F-actin binding protein); leukocyte specific protein 1; leukocyte-specific protein 1; lsp; LSP1; Lsp-1; lymphocyte specific 1; lymphocyte specific protein 1; lymphocyte-specific antigen WP34; Lymphocyte-specific protein 1; OTTHUMP00000014138; OTTHUMP00000069614; OTTHUMP00000069615; OTTHUMP00000069616; p50; pp52; S37; S37 protein; WP34 | |
| LSP1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LSP1 (aa 173-264) Control Fragment | |
| RUO | |
| LSP1 | |
| Unconjugated | |
| Recombinant | |
| PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |