missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LRRC4C (aa 570-633) Control Fragment Recombinant Protein

Catalog No. RP106572
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106572 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106572 Supplier Invitrogen™ Supplier No. RP106572

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111400. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Leucine-rich repeat-containing 4C (LRRC4C), also known as Netrin-G ligand 2 (NGL-2), is a gene highlighted for its expression in the nervous system, particularly the brain. It is a member of the leucine-rich repeat superfamily, which plays a significant role in cell adhesion and signaling pathways critical for synaptic connectivity and neuronal development. LRRC4C is involved in neural processes such as axon guidance and synapse formation, aiding in the establishment of functional neural circuits. Additionally, research has suggested that LRRC4C may function as a tumor suppressor, particularly in gliomas, indicating its potential role in neuro-oncological disorders. Variations or deletions in this gene have been linked to neurodevelopmental disorders, demonstrating its importance in normal brain function and development. Furthermore, LRRC4C's expression patterns and associations with cancer also suggest its potential as a prognostic marker in clinical settings.

Specifications

Accession Number Q9HCJ2
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 57689
Name Human LRRC4C (aa 570-633) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 6430556C10Rik; KIAA1580; leucine rich repeat containing 4C; leucine-rich repeat-containing protein 4C; Lrrc4c; Netrin-G1 ligand; NGL1; NGL-1; RGD1311013; UNQ292/PRO331
Common Name LRRC4C
Gene Symbol LRRC4C
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less