missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94003

Invitrogen™ Human LRRC40 (aa 343-432) Control Fragment Recombinant Protein

Catalog No. RP94003
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94003 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94003 Supplier Invitrogen™ Supplier No. RP94003
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55348 (PA5-55348. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRRC40 is a protein coding gene.

Specifications

Accession Number Q9H9A6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55631
Name Human LRRC40 (aa 343-432) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610040E16Rik; AI837674; dJ677H15.1; leucine rich repeat containing 40; leucine-rich repeat-containing protein 40; LOW QUALITY PROTEIN: leucine-rich repeat-containing protein 40; Lrrc40; testicular tissue protein Li 109
Common Name LRRC40
Gene Symbol LRRC40
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNPLRTIRREIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFDAVKSNIVTSINF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less