missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106771

Invitrogen™ Human LONRF2 (aa 226-291) Control Fragment Recombinant Protein

Catalog No. RP106771
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106771 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106771 Supplier Invitrogen™ Supplier No. RP106771
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66079 (PA5-66079. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LONRF2 contains one Lon domain, one RING type zinc finger and six TPR repeats. The function of LONRF2 is unknown. There are two named isoforms.

Specifications

Accession Number Q1L5Z9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 164832
Name Human LONRF2 (aa 226-291) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LON peptidase N-terminal domain and ring finger 2; LON peptidase N-terminal domain and RING finger protein 2; LONRF2; Neuroblastoma apoptosis-related protease; RING finger protein 192; RNF192
Common Name LONRF2
Gene Symbol LONRF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less