missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89755

Invitrogen™ Human LKB1 (aa 30-152) Control Fragment Recombinant Protein

Catalog No. RP89755
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89755 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89755 Supplier Invitrogen™ Supplier No. RP89755

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LKB1 (also known as STK11 - Serine/threonine-protein kinase STK11), a member of the serine/threonine kinase family, is a tumor suppressor. LKB1 physically associates with p53 and regulates specific p53 dependent apoptosis pathways. LKB1 is present in both the cytoplasm and nucleus of living cells and translocates to mitochondria during apoptosis. LKB1 functions as a master upstream protein kinase, regulating AMPK related kinases as well as AMPK. Mutations in LKB1 gene are associated with Peutz Jeghers syndrome.

Specifications

Accession Number Q15831
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6794
Name Human LKB1 (aa 30-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408040; CAMK group; CAMKL family; hLKB1; liver kinase B1; Liver kinase B1 homolog; LKB 1; LKB1; LKB-1; LKB1(S); Par-4; PJS; polarization-related protein LKB1; R75140; renal carcinoma antigen NY-REN-19; serine/threonine kinase 11; serine/threonine-protein kinase 11; serine/threonine-protein kinase LKB1; serine/threonine-protein kinase STK11; STK11
Common Name LKB1
Gene Symbol STK11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less