missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LIS1 (aa 16-161) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100462
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82710 (PA5-82710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
VAMP7 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family, localizing to late endosomes and lysosomes. VAMP7 is thought to mediate the fusion of endosomes to their target lysosomes as well as other exocytosis events during phagocytosis and neuritogenesis. VAMP7 interacts with the VPS9 ankyrin repeat protein VARP, a protein that localizes to early endosomes and thought to regulate endosome dynamics. Together with CD82, VAMP7 can modulate the signaling of EGFR by regulating its endocytosis from the plasma membrane.Specifications
| P43034 | |
| Blocking Assay, Control | |
| 5048 | |
| 100 μL | |
| HAMAP-Rule:MF_03141}; Lis1; Lis-1; LIS-1 {ECO:0000255; LIS2; lissencephaly 1 protein; lissencephaly-1 protein; lissencephaly-1 protein {ECO:0000255; MDCR; MDS; Mdsh; MGC25297; Miller-Dieker syndrome chromosome region; MMS10-U; Ms10u; NudF; PAF acetylhydrolase 45 kDa subunit; PAF acetylhydrolase 45 kDa subunit {ECO:0000255; PAFAH; PAF-AH 45 kDa subunit; PAF-AH 45 kDa subunit {ECO:0000255; PAFAH alpha; PAF-AH alpha; PAFAH alpha {ECO:0000255; PAF-AH alpha {ECO:0000255; PAF-AH beta; Pafah1b1; Pafaha; platelet activating factor acetylhydrolase 1 b regulatory subunit 1; platelet activating factor acetylhydrolase 45 kDa subunit brain isoform; platelet activating factor acetylhydrolase 45 kDa subunit brain isoform variant; platelet-activating factor acetylhydrolase 1 b, regulatory subunit 1; platelet-activating factor acetylhydrolase 1 b, regulatory subunit 1 (45 kDa); platelet-activating factor acetylhydrolase beta subunit (PAF-AH beta); platelet-activating factor acetylhydrolase IB subunit alpha; platelet-activating factor acetylhydrolase IB subunit alpha {ECO:0000255; platelet-activating factor acetylhydrolase, isoform 1 b, beta1 subunit; platelet-activating factor acetylhydrolase, isoform 1 b, subunit 1; platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45 kD); platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45 kDa; platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45 kDa); RP23-194P5.2 | |
| PAFAH1B1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LIS1 (aa 16-161) Control Fragment | |
| RUO | |
| LIS1 | |
| Unconjugated | |
| Recombinant | |
| ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |