missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LINGO3 (aa 361-430) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100012
Description
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65368 (PA5-65368, PA5-63211 (PA5-63211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
LINGO3 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include extracellular matrix; extracellular space; integral component of membrane.Specifications
| P0C6S8 | |
| Blocking Assay, Control | |
| 645191 | |
| 100 μL | |
| hCG2040376; LERN2; leucine rich repeat and Ig domain containing 3; leucine rich repeat neuronal 6 B; leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3; Leucine-rich repeat neuronal protein 2; leucine-rich repeat neuronal protein 6 B; LINGO3; LRRN6B | |
| LINGO3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LINGO3 (aa 361-430) Control Fragment | |
| RUO | |
| LINGO3 | |
| Unconjugated | |
| Recombinant | |
| LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |