missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LDB1 (aa 37-89) Control Fragment Recombinant Protein

Catalog No. RP95733
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95733 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95733 Supplier Invitrogen™ Supplier No. RP95733

Please call Customer Service at 1-800-234-7437 or send an email to help@thermofisher.com for assistance.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LIM domain-binding protein 1 (LDB1), also known as Carboxyl-terminal LIM domain-binding protein 2 (CLIM2), binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LDB1 may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. LDB1 acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It also acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. LDB1 strongly interacts with the LIM2 domain of LMX1A to form homodimer. LDB1 protein is expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. Due to alternative splicing events, three isoforms exist for LDB1.

Specifications

Accession Number Q86U70
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8861
Name Human LDB1 (aa 37-89) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias carboxy terminal LIM domain protein 2; carboxyl-terminal LIM domain-binding protein 2; CLIM2; CLIM-2; hLdb1; Ldb1; LDB-1; LIM domain binding 1; LIM domain-binding factor CLIM2; LIM domain-binding factor-1; LIM domain-binding protein 1; mLdb1; NLI; Nuclear LIM interactor
Common Name LDB1
Gene Symbol LDB1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less