missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LAPTM5 (aa 216-250) Control Fragment Recombinant Protein

Catalog No. RP101410
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101410 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101410 Supplier Invitrogen™ Supplier No. RP101410

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62370 (PA5-62370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis.

Specifications

Accession Number Q13571
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7805
Name Human LAPTM5 (aa 216-250) Control Fragment
Quantity 100 μL
Gene Alias CD40-ligand-activated specific transcripts; CLAST6; gcd-10; granule cell death-10; human retinoic acid-inducible E3 protein; KIAA0085; LAPTM5; lysosomal associated multispanning membrane protein 5; lysosomal multispanning membrane protein 5; lysosomal protein transmembrane 5; lysosomal-associated multitransmembrane protein 5; lysosomal-associated protein transmembrane 5; lysosomal-associated transmembrane protein 5; Retinoic acid-inducible E3 protein
Common Name LAPTM5
Gene Symbol LAPTM5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less