missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108162

Invitrogen™ Human Laminin alpha-1 Control Fragment Recombinant Protein

Catalog No. RP108162
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108162 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108162 Supplier Invitrogen™ Supplier No. RP108162

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Laminin antibodies are widely used to label blood vessels and basement membranes.

Specifications

Accession Number P25391
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284217
Name Human Laminin alpha-1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LAMA; LAMA1; Laminin A chain; laminin subunit alpha 1; laminin subunit alpha-1; laminin, alpha 1; Laminin-1 subunit alpha; Laminin-3 subunit alpha; PTBHS; S-LAM alpha; S-LAM-alpha; S-laminin subunit alpha
Common Name Laminin alpha-1
Gene Symbol LAMA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHATEFQRLADVLYSGLENIRNVSLNATSAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less