missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93657

Invitrogen™ Human L3MBTL3 (aa 99-173) Control Fragment Recombinant Protein

Catalog No. RP93657
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93657 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93657 Supplier Invitrogen™ Supplier No. RP93657

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84139 (PA5-84139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility.

Specifications

Accession Number Q96JM7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84456
Name Human L3MBTL3 (aa 99-173) Control Fragment
Quantity 100 μL
Gene Alias AI481284; H-l(3)mbt-like protein 3; KIAA1798; l(3)mbt-like 3; l(3)mbt-like 3 (Drosophila); l(3)mbt-like protein 3; L3MBTL histone methyl-lysine binding protein 3; L3mbtl3; L3MBTL3, histone methyl-lysine binding protein; lethal(3)malignant brain tumor-like protein 3; lethal(3)malignant brain tumor-like protein 3; LOW QUALITY PROTEIN: lethal(3)malignant brain tumor-like protein 3; MBT1; MBT-1
Common Name L3MBTL3
Gene Symbol L3MBTL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less