missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KTI12 (aa 32-96) Control Fragment Recombinant Protein

Catalog No. RP94555
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94555 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94555 Supplier Invitrogen™ Supplier No. RP94555

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56671 (PA5-56671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.

Specifications

Accession Number Q96EK9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 112970
Name Human KTI12 (aa 32-96) Control Fragment
Quantity 100 μL
Gene Alias KTI12; KTI12 chromatin associated homolog; KTI12 homolog, chromatin associated; KTI12 homolog, chromatin associated (S. cerevisiae); protein KTI12 homolog; RP11-91A18.3; SBBI81; TOT4
Common Name KTI12
Gene Symbol KTI12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VYVVDDAAVLGAEDPAVYGDSAREKALRGALRASVERRLSRHDVVILDSLNYIKGFRYELYCLAR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less