missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101205

Invitrogen™ Human KLHL24 (aa 1-74) Control Fragment Recombinant Protein

Catalog No. RP101205
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101205 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101205 Supplier Invitrogen™ Supplier No. RP101205

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63289 (PA5-63289. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL24 is specifically reduces kainate receptor-mediated currents in hippocampal neurons, most probably by modulating channel properties.

Specifications

Accession Number Q6TFL4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54800
Name Human KLHL24 (aa 1-74) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110046J11Rik; 4930429H24Rik; 6530402O20Rik; C85082; DRE1; kainate receptor interacting protein for GluR6; kainate receptor-interacting protein for GluR6; kelch like family member 24; kelch-like 24; kelch-like family member 24; kelch-like protein 24; Klhl24; KRIP6; Protein DRE1
Common Name KLHL24
Gene Symbol KLHL24
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less