missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98369

Invitrogen™ Human KLF5 (aa 285-382) Control Fragment Recombinant Protein

Catalog No. RP98369
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98369 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98369 Supplier Invitrogen™ Supplier No. RP98369
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLF5 is a member of the Kruppel-like factor subfamily of zinc finger proteins. It contains three C2H2-type zinc fingers at the carboxyl-terminus that preferentially bind to cis-DNA elements that are GC rich. KLF5 is a transcription activator that promotes cell proliferation and oncogenesis.

Specifications

Accession Number Q13887
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 688
Name Human KLF5 (aa 285-382) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (intestinal Kruppel-like factor; 4930520J07Rik; basic transcription element binding protein 2; basic transcription element binding protein BTEB2; basic transcription element-binding protein 2; BTEB2; BTE-binding protein 2; CKLF; colon krueppel-like factor; colon kruppel-like factor; GC box binding protein 2; GC-box-binding protein 2; IKLF; Intestinal-enriched krueppel-like factor; intestinal-enriched kruppel-like factor; Klf5; Klf5C isoform; Krueppel-like factor 5; Kruppel like factor 5; Kruppel-like factor 5; Kruppel-like factor 5 (intestinal); RP11-505F3.5; transcription factor BTEB2
Common Name KLF5
Gene Symbol KLF5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less