missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Kir3.4 (KCNJ5) (aa 17-71) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP90943
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53594 (PA5-53594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
G protein-coupled inwardly rectifying potassium channels (Kir3.1 through Kir3.4) are coupled to numerous neurotransmitter receptors in the brain and are abundantly expressed in the olfactory bulb, hippocampus, neocortex, dentate gyrus, cerebellar cortex and thalamus regions of the brain. Also known as GIRK, Kir3 potassium channels localize to the soma and dendrites as well as axons of neurons. Liberated Gbg subunits from G protein heterotrimers bind to and regulate Kir3 channel activity. Gb3- and Gb4-containing Gbg dimers bind directly to cytoplasmic domains of Kir3 proteins and increase the K+ current while Gb5-containing Gbg dimers inhibit Kir3 K+ current. Kir3 activity is also inhibited by tyrosine phosphorylation. Brain-derived neurotrophic factor activates receptor tyrosine kinase B, which then phosphorylates Kir3 tyrosine residues, effectively inactivating the Kir3 channels.Specifications
| P48544 | |
| Blocking Assay, Control | |
| 3762 | |
| 100 μL | |
| cardiac ATP-sensitive potassium channel; cardiac inward rectifier; CIR; G protein-activated inward rectifier potassium channel 4; GIRK4; GIRK-4; Heart KATP channel; inward rectifier K(+) channel Kir3.4; inward rectifier K+ channel KIR3.4; IRK4; IRK-4; KATP1; KATP-1; KCNJ5; Kir3.4; LQT13; Potassium channel, inwardly rectifying subfamily J member 5; potassium channel, inwardly rectifying subfamily J, member 5; potassium inwardly-rectifying channel, subfamily J, member 5; potassium voltage-gated channel subfamily J member 5 | |
| KCNJ5 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Kir3.4 (KCNJ5) (aa 17-71) Control Fragment | |
| RUO | |
| Kir3.4 (KCNJ5) | |
| Unconjugated | |
| Recombinant | |
| VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |