missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91128

Invitrogen™ Human Kir2.2 (KCNJ12) (aa 356-433) Control Fragment Recombinant Protein

Catalog No. RP91128
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91128 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91128 Supplier Invitrogen™ Supplier No. RP91128

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55485. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inward rectifying potassium channel that is activated by phosphatidylinositol 4,5-bisphosphate and that probably participates in controlling the resting membrane potential in electrically excitable cells. Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.

Specifications

Accession Number Q14500
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3768
Name Human Kir2.2 (KCNJ12) (aa 356-433) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias ATP-sensitive inward rectifier potassium channel 12; atrium potassium channel IRK; DirK; hIRK; hIRK1; hkir2.2x; Inward rectifier K(+) channel Kir2.2; inward rectifier K(+) channel Kir2.2v; inward rectifier K(+) channel Kir2.6; inward rectifier potassium channel Kir2.2; inwardly-rectifying potassium channel KCNJ12; inwardly-rectifying potassium channel Kir2.2; IRK; Irk2; IRK-2; KCNJ12; kcnj12x; KCNJN1; Kir2.1; Kir2.2; Kir2.2v; MB-IRK2; potassium channel, inwardly rectifying subfamily J member 12; potassium channel, inwardly rectifying subfamily J, member 12; potassium inwardly rectifying channel subfamily J member 12; potassium inwardly-rectifying channel J12; potassium inwardly-rectifying channel, subfamily J, inhibitor 1; potassium inwardly-rectifying channel, subfamily J, member 12; potassium voltage-gated channel subfamily J member 12; subfamily J, member 12
Common Name Kir2.2 (KCNJ12)
Gene Symbol Kcnj12
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less