missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human KIF1C Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100039
Description
Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60899 (PA5-60899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The kinesins constitute a large family of microtubule-dependent motor proteins, which are responsible for the distribution of numerous organelles, vesicles and macromolecular complexes throughout the cell. Individual kinesin members play crucial roles in cell division, intracellular transport, and membrane trafficking events including endocytosis and transcytosis. KIF1C is a member of the KIF1/Unc104 family of kinesin-like proteins, which are involved in the transport of mitochondria or synaptic vesicles in axons. Human KIF1C maps to chromosome 17p13 and encodes a predicted 1,103 amino acid protein with abundant expression in heart and skeletal muscle. Tyrosine phosphorylation is a putative regulator of KIF1C mediated retrograde transport of Golgi vesicles to the endoplasmic reticulum. KIF1C is capable of forming homodimers and can noncovalently associate with 14-3-3 beta, gamma, epsilon and zeta. In mouse macrophages, KIF1C is required for anthrax lethal toxin resistance.Specifications
| O43896 | |
| Blocking Assay, Control | |
| 10749 | |
| 100 μL | |
| B430105J22Rik; D11Bwg1349e; KIAA0706; Kif1c; Kif1d; kinesin 1 C; kinesin family member 1 C; kinesin superfamily protein 1 C; kinesin-like protein KIF1C; Kinesin-like protein KIF1D; lethal factor toxin susceptibility 1; Ltxs1; N-3 kinsin; SAT x 2; SA x 2; spastic ataxia 2 (autosomal recessive); SPA x 2; SPG58 | |
| KIF1C | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human KIF1C Control Fragment | |
| RUO | |
| KIF1C | |
| Unconjugated | |
| Recombinant | |
| QAHICKLMGILQQVKLQNSSKDWELQALQDRMVCMERIIPLAQDHEDENEEGGEFHWA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |