missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KIAA1751 (aa 557-644) Control Fragment Recombinant Protein

Catalog No. RP94252
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94252 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94252 Supplier Invitrogen™ Supplier No. RP94252

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55889 (PA5-55889. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As part of the central apparatus of the cilium axoneme may play a role in cilium movement. [UniProt]

Specifications

Accession Number Q9C0B2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85452
Name Human KIAA1751 (aa 557-644) Control Fragment
Quantity 100 μL
Gene Alias C1orf222; CFAP74; cilia and flagella associated protein 74; cilia- and flagella-associated protein 74; FLJ45476; hCG1647286-like; KIAA1751; LOW QUALITY PROTEIN: cilia- and flagella-associated protein 74
Common Name KIAA1751
Gene Symbol CFAP74
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKDLEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELIDFGSYVVGETTSRTITLTN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less