missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102696

Invitrogen™ Human KCTD6 (aa 168-237) Control Fragment Recombinant Protein

Catalog No. RP102696
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102696 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102696 Supplier Invitrogen™ Supplier No. RP102696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57520 (PA5-57520. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCTD6 is a domain of potassium channel.

Specifications

Accession Number Q8NC69
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 200845
Name Human KCTD6 (aa 168-237) Control Fragment
Quantity 100 μL
Gene Alias 5430433B02Rik; AU044285; BTB/POZ domain-containing protein KCTD6; hypothetical protein LOC436601; KCASH3; KCASH3 protein; KCTD6; kctd6b; potassium channel tetramerisation domain containing 6; potassium channel tetramerisation domain containing 6 b; potassium channel tetramerization domain containing 6; potassium channel tetramerization domain containing 6 b; Potassium channel tetramerization domain-containing protein 6; zgc:91884
Common Name KCTD6
Gene Symbol KCTD6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less