missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KCTD16 (aa 116-186) Control Fragment Recombinant Protein

Catalog No. RP96972
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96972 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96972 Supplier Invitrogen™ Supplier No. RP96972
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60766 (PA5-60766. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. KCTD16 (potassium channel tetramerisation domain containing 16), also known as BTB/POZ domain-containing protein KCTD16, is a 428 amino acid protein that contains one BTB (POZ) domain. An auxiliary subunit of GABAB R1 and GABAB R2, KCTD16 increases agonist potency and alters the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Specifications

Accession Number Q68DU8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57528
Name Human KCTD16 (aa 116-186) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930434H12Rik; BTB/POZ domain-containing protein KCTD16; Gm1267; KCTD16; KIAA1317; potassium channel tetramerisation domain containing 16; potassium channel tetramerization domain containing 16; potassium channel tetramerization domain-containing protein 16
Common Name KCTD16
Gene Symbol KCTD16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less