missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103292

Invitrogen™ Human KCNQ2 (aa 622-696) Control Fragment Recombinant Protein

Catalog No. RP103292
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103292 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103292 Supplier Invitrogen™ Supplier No. RP103292

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCNQs are members of the voltage-dependent non-inactivating potassium channel family. Currently there are five known KNCQs (KCNQ1-5) found in the central nervous system and KNCQ2 and 3 have demonstrated their importance in M-current activation. Studies have shown that KCNQ2 and KCNQ3 form heteromultimers that, when formed, substantially increase the M-current. Inhibition of M-current controls neuron excitability throughout the nervous system as well as the responsiveness to synaptic inputs. Genetic mutations in these proteins have been linked to disorders such as benign familial neonatal convulsions (BFNC), deafness, neuropathic pain and epilepsy.

Specifications

Accession Number O43526
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3785
Name Human KCNQ2 (aa 622-696) Control Fragment
Quantity 100 μL
Gene Alias BFNC; EBN; EBN1; ENB1; HNSPC; KCNA11; KCNQ2; KQT like 2; KQT2; KQT-like 2; KV7.2; KVEBN1; mKQT2.3; mKQT2.4; neuroblastoma-specific potassium channel subunit alpha KvLQT2; Nmf134; potassium channel subunit alpha KvLQT2; potassium channel, voltage gated KQT-like subfamily Q, member 2; potassium channel, voltage-gated KQT-like subfamily Q, member 2; potassium voltage-gated channel KQT-like subfamily member 2.3; potassium voltage-gated channel KQT-like subfamily member 2.4; potassium voltage-gated channel subfamily KQT member 2; potassium voltage-gated channel subfamily Q member 2; potassium voltage-gated channel, KQT-like subfamily, member 2; potassium voltage-gated channel, subfamily Q, member 2; voltage-gated potassium channel subunit Kv7.2
Common Name KCNQ2
Gene Symbol KCNQ2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSPEDSREHVDRHGCIVKIVRSSSST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less