missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91042

Invitrogen™ Human KCNMB3 (aa 94-195) Control Fragment Recombinant Protein

Catalog No. RP91042
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91042 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91042 Supplier Invitrogen™ Supplier No. RP91042
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82533 (PA5-82533. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22.

Specifications

Accession Number Q9NPA1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27094
Name Human KCNMB3 (aa 94-195) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias big potassium channel beta subunit 3; BK beta 3; BK channel beta subunit 3; BK channel subunit beta-3; BKbeta3; calcium-activated potassium channel regulatory subunit; calcium-activated potassium channel subfamily M subunit beta-3; Calcium-activated potassium channel subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; Charybdotoxin receptor subunit beta-3; EG435726; EMBL:BAF79924.1}; Gm5707; HBETA3; K(VCA)BETA-3; KCNMB2; KCNMB3; kcnmb3 {ECO:0000312; KCNMBL; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; maxi K channel subunit beta-3; MaxiK channel beta-subunit 3; potassium calcium-activated channel subfamily M regulatory beta subunit 3; potassium channel subfamily M regulatory beta subunit 3; potassium large conductance calcium-activated channel, subfamily M beta member 3; potassium large conductance calcium-activated channel, subfamily M, beta member 3; potassium large conductance calcium-activated channel, subfamily M, beta member 4; SLOBETA3; SLO-BETA-3; slobeta3 (KCNMB3)
Common Name KCNMB3
Gene Symbol KCNMB3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less