missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91148

Invitrogen™ Human KCNK1 (aa 281-335) Control Fragment Recombinant Protein

Catalog No. RP91148
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91148 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91148 Supplier Invitrogen™ Supplier No. RP91148
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53413 (PA5-53413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq, Jul 2008].

Specifications

Accession Number O00180
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3775
Name Human KCNK1 (aa 281-335) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI788889; double-pore potassium channel; DPK; HOHO; HOHO1; Inward rectifying potassium channel protein TWIK-1; K2P1; K2p1.1; Kcnk1; kcnk1 {ECO:0000312; KCNO1; Potassium channel K2P1; potassium channel KCNO1; Potassium channel subfamily K member 1; potassium channel TWIK-1; potassium channel, subfamily K, member 1; potassium channel, two pore domain subfamily K, member 1; potassium inwardly-rectifying channel, subfamily K, member 1; potassium two pore domain channel subfamily K member 1; putative potassium channel TWIK; rabKCNK1; RGD:621447}; rTWIK; tandem of P domains in a weak inward rectifying K+ channel 1; Twik; TWIK1; TWIK-1; two-pore potassium channel; Unknown (protein for MGC:142788)
Common Name KCNK1
Gene Symbol Kcnk1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less