missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91200

Invitrogen™ Human KCNH7 (aa 886-1016) Control Fragment Recombinant Protein

Catalog No. RP91200
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91200 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91200 Supplier Invitrogen™ Supplier No. RP91200

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53713 (PA5-53713. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. There are at least two alternatively spliced transcript variants derived from this gene and encoding distinct isoforms.

Specifications

Accession Number Q9NS40
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90134
Name Human KCNH7 (aa 886-1016) Control Fragment
Quantity 100 μL
Gene Alias 9330137I11Rik; eag-related protein 3; erg3; ERG-3; ether-a-go-go-related gene potassium channel 3; ether-a-go-go-related protein 3; H Kv11.3; HERG3; KCNH7; Kv11.3; potassium channel erg3; potassium channel protein erg3; potassium channel subunit HERG-3; potassium channel, voltage gated eag related subfamily H, member 7; potassium voltage-gated channel subfamily H member 7; potassium voltage-gated channel, subfamily H (eag-related), member 7; voltage-gated potassium channel subunit Kv11.3
Common Name KCNH7
Gene Symbol KCNH7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DNCKLRRRKLSFESEGEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less