missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99645

Invitrogen™ Human KANSL1L (aa 248-343) Control Fragment Recombinant Protein

Catalog No. RP99645
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99645 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99645 Supplier Invitrogen™ Supplier No. RP99645

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60240 (PA5-60240. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C2orf67, also termed as chromosome 2 open reading frame 67, encodes a 705 amino-acid protein. It exists a variant, which encodes 987 amino-acid protein. The C2orf56 may express in lymphoid /immune and nervous system. The specific function of C2orf67 is still non-known.

Specifications

Accession Number A0AUZ9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 151050
Name Human KANSL1L (aa 248-343) Control Fragment
Quantity 100 μL
Gene Alias 1110028C15Rik; 1190030G24; AI427598; C2orf67; C430010P07Rik; Kansl1l; KAT8 regulatory NSL complex subunit 1 like; KAT8 regulatory NSL complex subunit 1-like; KAT8 regulatory NSL complex subunit 1-like protein; Kiaa4189; male-specific lethal 1 homolog; mKIAA4189; MSL1v2
Common Name KANSL1L
Gene Symbol KANSL1L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLAKHVVKHYGQQMKLSMKHQLPKMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less