missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109933

Invitrogen™ Human Kallikrein 5 (aa 191-241) Control Fragment Recombinant Protein

Catalog No. RP109933
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109933 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109933 Supplier Invitrogen™ Supplier No. RP109933

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel KLK gene, KLK12, is expressed in a variety of tissues including salivary gland, stomach, uterus, lung, thymus, prostate, colon, brain, thyroid, and trachea. It has applications as a novel cancer biomarker.

Specifications

Accession Number Q9Y337
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25818
Name Human Kallikrein 5 (aa 191-241) Control Fragment
Quantity 100 μL
Gene Alias 1110030O19Rik; HK5; kallikrein 5; Kallikrein L2; Kallikrein like 2; kallikrein related peptidase 5; kallikrein related-peptidase 5; Kallikrein5; kallikrein-5; kallikrein-5-like; kallikrein-like protein 2; kallikrein-related peptidase 5; KLK 5; KLK L2; KLK5; KLK-5; KLKL 2; KLKL2; KLK-L2; LOC102546758; SCTE; Stratum corneum tryptic enzyme; UNQ570/PRO1132
Common Name Kallikrein 5
Gene Symbol Klk5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less