missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105061

Invitrogen™ Human JMJD1B (aa 740-814) Control Fragment Recombinant Protein

Catalog No. RP105061
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105061 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105061 Supplier Invitrogen™ Supplier No. RP105061

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.

Specifications

Accession Number Q7LBC6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51780
Name Human JMJD1B (aa 740-814) Control Fragment
Quantity 100 μL
Gene Alias 5830462I21Rik; 5 qNCA; C5orf7; JHDM2B; JmjC domain-containing histone demethylation protein 2 B; JMJD1B; jumonji domain containing 1 B; jumonji domain-containing protein 1 B; KDM3B; KDM3B lysine (K)-specific demethylase 3 B; KIAA1082; lysine (K)-specific demethylase 3 B; lysine demethylase 3 B; lysine-specific demethylase 3 B; mKIAA1082; NET22; Nuclear protein 5 qNCA
Common Name JMJD1B
Gene Symbol KDM3B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less