missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human JAM3 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104900
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
JAM3 is involved in tight junctions and represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.Specifications
| Q9BX67 | |
| Blocking Assay, Control | |
| 83700 | |
| 100 μL | |
| 1110002N23Rik; JAM-2; JAM3; JAM-3; JAMC; JAM-C; Jcam3; junction adhesion molecule 3; junction cell adhesion molecule 3; junction cell adhesion molecule C; junctional adhesion molecule 3; Junctional adhesion molecule C; sJAM-C; Soluble form of JAM-C; UNQ859/PRO1868 | |
| JAM3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human JAM3 Control Fragment | |
| RUO | |
| JAM3 | |
| Unconjugated | |
| Recombinant | |
| SATLDMALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |