missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103515

Invitrogen™ Human ITGA2 (aa 770-858) Control Fragment Recombinant Protein

Catalog No. RP103515
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103515 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103515 Supplier Invitrogen™ Supplier No. RP103515

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84600 (PA5-84600. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD49b (Integrin alpha 2, Integrin alpha 2 chain, VLA-2 alpha chain, HM alpha 2) is a member of the integrin family. It is a glycoprotein with molecular weight of 150 kD, and it complexes with CD29 (Integrin beta 1) to form the heterodimeric integrin VLA-2 (integrin alpha 2 beta 1, or GPIa/IIa) complex. VLA-2 is an extracellular receptor for laminin, collagen, and fibronectin, and interaction with its ligands results in the activation of intracellular signaling pathways. It has reported roles in VEGF-induced angiogenesis in vivo, as well as adhesion and lymphocyte activation. CD49b is expressed by NK cells, NK-T cells, monocytes, platelets, and epithelial cells. It is also expressed on adaptive immune cells such as T and B cells, specifically on a subset of CD4+ T cells in the spleen, on intraepithelial and lamina propria lymphocytes in the intestine, as well as on a population of peripheral CD4+ type 1 T regulatory (Tr1) cells that co-express LAG-3.

Specifications

Accession Number P17301
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3673
Name Human ITGA2 (aa 770-858) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha 2 subunit of VLA-2 receptor; BDPLT9; BR; CD49 antigen-like family member B; CD49B; Collagen receptor; D x 5; GPIa; HPA-5; human platelet alloantigen system 5; integrin alpha 2; integrin alpha-2; integrin subunit alpha 2; integrin, alpha 2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); Itga2; platelet antigen Br; platelet glycoprotein GPIa; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; VLA-2; VLA2 receptor; VLA-2 receptor, alpha 2 subunit; VLA-2 subunit alpha; VLAA2
Common Name CD49b (Integrin alpha 2)
Gene Symbol Itga2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less