missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106475

Invitrogen™ Human ISPD (aa 93-178) Control Fragment Recombinant Protein

Catalog No. RP106475
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106475 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106475 Supplier Invitrogen™ Supplier No. RP106475

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65803 (PA5-65803. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for protein O-linked mannosylation. Probably acts as a nucleotidyltransferase involved in synthesis of a nucleotide sugar. Required for dystroglycan O-mannosylation.

Specifications

Accession Number A4D126
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 729920
Name Human ISPD (aa 93-178) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein; 4930579E17Rik; 4-diphosphocytidyl-2 C-methyl-D-erythritol synthase homolog; AV040780; Crppa; D-ribitol-5-phosphate cytidylyltransferase; hCG_1745121; hISPD; isoprenoid synthase domain containing; isoprenoid synthase domain-containing protein; Ispd; MDDGA7; MDDGC7; Nip; notch1-induced protein; testicular tissue protein Li 97
Common Name ISPD
Gene Symbol ISPD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAEDQINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less