missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human IRF6 (aa 89-144) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP103781
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84583 (PA5-84583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.Specifications
| O14896 | |
| Blocking Assay, Control | |
| 3664 | |
| 100 μL | |
| AI876454; E230028I05Rik; interferon regulatory factor 6; IRF6; IRF-6; irf6 protein; IRF-6; transcription factor; LPS; mirf6; OFC6; PIT; PPS; PPS1; transcriptional factor; VWS; VWS1; zgc:63500 | |
| Irf6 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human IRF6 (aa 89-144) Control Fragment | |
| RUO | |
| IRF6 | |
| Unconjugated | |
| Recombinant | |
| KSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDNDVDEE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |