missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103186

Invitrogen™ Human IRAK1 (aa 14-104) Control Fragment Recombinant Protein

Catalog No. RP103186
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103186 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103186 Supplier Invitrogen™ Supplier No. RP103186

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL-1 receptor associated kinases (IRAKs) are serine/threonine kinases involved in signaling via Toll/IL-1 pathways. It is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation. IRAK's association with MYD88 leads to IRAK1 phosphorylation by IRAK4 and subsequent autophosphorylation and kinase activation. Alternatively, IRAK1 can phosphorylate TIRAP to promote its ubiquitination and subsequent degradation. IRAK1 also phosphorylates the interferon regulatory factor 7 (IRF7) to induce its activation and translocation to the nucleus. This results in the transcriptional activiation of type I IFN genes, which drive the cell in an antiviral state.

Specifications

Accession Number P51617
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3654
Name Human IRAK1 (aa 14-104) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AA408924; Il1rak; interleukin 1 receptor associated kinase 1; interleukin-1 receptor-associated kinase 1; interleukin-1 receptor-associated kinase-1; IRAK; Irak1; IRAK-1; IRAK1-S; mPLK; pelle; Pelle homolog; pelle-like protein kinase; Plpk; RGD1563841
Common Name IRAK1
Gene Symbol Irak1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less