missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Involucrin (aa 3-77) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101412
Description
Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84245 (PA5-84245. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. Involucrin is expressed in a range of stratified squamous epithelia, including the cornea. In normal epidermis, it is first expressed in the upper spinous layers, and in keratinocyte cultures it is expressed by all cells that have left the basal layer. Involucrin expression is abnormal in squamous cell carcinomas and premalignant lesions and is reduced in severe dysplasias of the larynx and cervix. Its gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin.Specifications
| P07476 | |
| Blocking Assay, Control | |
| 3713 | |
| 100 μL | |
| 1110019C06Rik; involucrin; IVL | |
| IVL | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Involucrin (aa 3-77) Control Fragment | |
| RUO | |
| Involucrin | |
| Unconjugated | |
| Recombinant | |
| QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |