missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human IL10RA (aa 268-339) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109093
Description
Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene.Specifications
| Q13651 | |
| Blocking Assay, Control | |
| 3587 | |
| 100 μL | |
| AW553859; CD210; CD210a; CDw210; CDW210A; CDW210B; CRF2-4; CRFB4; D21S58; D21S66; HIL-10 R; I10R; I10R1; il-10 receptor; il-10 receptor antagonist; IL-10 receptor subunit alpha; IL10R; IL-10 R alpha; IL-10 R subunit 1; IL-10 R subunit alpha; IL-10R1; IL-10R2; Il10ra; IL-10 RA; interleukin 10 receptor subunit alpha; interleukin 10 receptor, alpha; interleukin-10 receptor alpha chain; interleukin-10 receptor subunit 1; Interleukin-10 receptor subunit alpha; mIL-10 R | |
| Il10ra | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human IL10RA (aa 268-339) Control Fragment | |
| RUO | |
| IL10RA | |
| Unconjugated | |
| Recombinant | |
| SVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |